PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT20012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 958aa    MW: 104340 Da    PI: 6.1571
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT20012genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.46.1e-28582633152
    RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
               aek+i +++l+kyFs+++kdAAk+Lgvc+T+LKriCR +GI+RWP+Rki+++
  EMT20012 582 AEKNIGMDVLRKYFSGSLKDAAKSLGVCPTTLKRICRTHGISRWPSRKINKV 633
               589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557812.59E-5210289IPR029016GAF domain-like
Gene3DG3DSA:3.30.450.407.6E-4239298IPR029016GAF domain-like
PROSITE profilePS5151916.54567653IPR003035RWP-RK domain
PfamPF020422.7E-25585633IPR003035RWP-RK domain
SuperFamilySSF542771.21E-23851939No hitNo description
Gene3DG3DSA:3.10.20.2404.3E-23853935No hitNo description
SMARTSM006663.4E-18856938IPR000270PB1 domain
PROSITE profilePS5174522.582856938IPR000270PB1 domain
PfamPF005648.2E-16857937IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 958 aa     Download sequence    Send to blast
MDVPLPSQSN RAGCNGSVGS PSDDPYGVTA MMNFDGYSEL CGSPSLADQL FSLLNDSSTH  60
QMFAMWSSLG SSPRASGVSE DMQLDAYSSV PGDQKVDLVS SVNPAENGTG RMAKSSGDLG  120
SDGDPEQGST SVVPRPIAGN LLAERMLMAL SLFRKSLGGG VLAQVWMPVE QEGHVVLSTC  180
EQPFLLDQAL AGYREVSRHF VFSAKEETCL QPGLPGRVFI SGVPEWTSNV LYYSKPEYLR  240
MEYALHHEVR GSLAMPIYDP SKGSCCAVLE LITKKEKPDF DAEMNNLRHA LQASCELGDS  300
KRLYRSEGAI LHFSEISAVH HGCWIQVYSA NQKATFTEIL DVLRAICHAH MLPLALTWVP  360
SSNGSDGGYV GHDNVLDSQS GKAILRIHES ACYVNDAKMQ GFFHACTETH LEKGQGIAGR  420
ALKSNLPFFS PNIREYGIKD YPLAHHARKF GLHAAVAIRL RSTYTGDDDY ILEFFLPINC  480
TGSEEQQMLL NNLSSTMQRI CKSLRTVSEA EVDKVDACTA VMYKATSGSC LPTGQSGSSS  540
HGDQPATEEA FQDLSLIDKQ GDMSEQAQSS SMRLAEKKRS TAEKNIGMDV LRKYFSGSLK  600
DAAKSLGVCP TTLKRICRTH GISRWPSRKI NKVNRSLKKI QTVINSVHGV DSSLQYDPAT  660
GSLVPAVSLP EKTSFPSCDA VSSPSVGKTV DEKSGPKSEQ GYSSPEGWER DSCQLQRPDA  720
QKGEGDEFHM QTTNYSGSGD HGSYGPNVTH HIISEGTQGP LYPTGAVSAL HDKETGCIEP  780
LPCVLPSIKT TRDQIVGRNS PPMQQADIDM FDDREGREHT HPSTSGMTDS SSGSASSHPT  840
FKKNPARPLK DKSSPALTVK ATYNGDTVRF KFLPSMGWYH LLEEIAKRFK LSTGVFQLKY  900
KDDEDEWVIM ANDSDLQECV DVMDSMGTRN VKLQVRDLPC LISSSGSSCC LQLEGHNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240492.10.0PREDICTED: protein NLP2-like
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLR7WBQ70.0R7WBQ7_AEGTA; Uncharacterized protein
STRINGMLOC_37423.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-179Nin-like family protein